Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6W3
Confidence2.52%DateThu Jan 5 11:04:03 GMT 2012
Rank89Aligned Residues27
% Identity19%Templatec3euhF_
PDB info PDB header:cell cycleChain: F: PDB Molecule:muke; PDBTitle: crystal structure of the muke-mukf complex
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   297..300.........310.........320.........
Predicted Secondary structure 











Query SS confidence 
































Query Sequence  FVVETLSVILQVGSFKLRGQRIFRMAPIHHHYE
Query Conservation         
      
   
   
  
  
 
  
Alig confidence 









......
















Template Conservation 



 

  
......
 
  
  

   



Template Sequence  PLFPALDSAL. . . . . . RSGRHIGLDELDNHAFL
Template Known Secondary structure  TT......TTT

B
SSS
Template Predicted Secondary structure 


......







Template SS confidence 
































   30......... 40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions