Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABX2
Confidence0.50%DateThu Jan 5 11:16:37 GMT 2012
Rank78Aligned Residues28
% Identity32%Templatec3kwrA_
PDB info PDB header:rna binding proteinChain: A: PDB Molecule:putative rna-binding protein; PDBTitle: crystal structure of putative rna-binding protein (np_785364.1) from2 lactobacillus plantarum at 1.45 a resolution
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.........60
Predicted Secondary structure 

























Query SS confidence 







































Query Sequence  LNVAASNLANADSVTGPDGQPYRAKQVVFQVNAAPGAATG
Query Conservation 
  

 




 
        
    
             
Alig confidence 










............
















Template Conservation 










............
















Template Sequence  VQVAADNAANA. . . . . . . . . . . . LAIALFEQSLPPASDPQ
Template Known Secondary structure  ............TTS






GG
Template Predicted Secondary structure 




............








Template SS confidence 







































   38.40........ .50.........60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions