Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABX2
Confidence0.62%DateThu Jan 5 11:16:37 GMT 2012
Rank50Aligned Residues33
% Identity30%Templatec1rz4A_
PDB info PDB header:biosynthetic proteinChain: A: PDB Molecule:eukaryotic translation initiation factor 3 subunit 11; PDBTitle: crystal structure of human eif3k
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   77..80.........90.........100.........110.. .......120..
Predicted Secondary structure 












..
Query SS confidence 



































. .









Query Sequence  VYEPGNPLADAKGYVKMPNVDVVGEMVNTMSASRSY. . QANVEVLNTV
Query Conservation          
   
    



   

  
    
 
.. 

       
Alig confidence 




.............

















..









Template Conservation 




............. 
  

 

  
     


 








Template Sequence  RYNPE. . . . . . . . . . . . . NLATLERYVETQAKENAYDLEANLAVLKLY
Template Known Secondary structure  GG
GG.............GT


Template Predicted Secondary structure 


.............




Template SS confidence 















































   20.... .....30.........40.........50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions