Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACS5
Confidence77.43%DateThu Jan 5 11:18:54 GMT 2012
Rank81Aligned Residues43
% Identity14%Templatec3h5tA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, laci family; PDBTitle: crystal structure of a transcriptional regulator, lacl2 family protein from corynebacterium glutamicum
Resolution2.53 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........
Predicted Secondary structure 























Query SS confidence 
























































Query Sequence  RIGELAKMAEVTPDTIRYYEKQQMMEHEVRTEGGFRLYTESDLQRLKFIRHARQLGF
Query Conservation   
 


   


  





  


 
  
    

 
    
  
  
  

  
 
Alig confidence 



















............

















..




Template Conservation 

 


   


  





............
    

  

 

   
..  


Template Sequence  TLASIAAKLGISRTTVSNAY. . . . . . . . . . . . NRPEQLSAELRQRILDTA. . EDMGY
Template Known Secondary structure  TS
............
GGGS
..TT
Template Predicted Secondary structure 



............






..

Template SS confidence 
























































   11........20.........30 .........40........ .50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions