Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACS5
Confidence89.83%DateThu Jan 5 11:18:54 GMT 2012
Rank31Aligned Residues46
% Identity24%Templatec3clcC_
PDB info PDB header:transcription regulator/dnaChain: C: PDB Molecule:regulatory protein; PDBTitle: crystal structure of the restriction-modification controller protein2 c.esp1396i tetramer in complex with its natural 35 base-pair operator
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60....
Predicted Secondary structure 

























Query SS confidence 






























































Query Sequence  YRIGELAKMAEVTPDTIRYYEKQQMMEHEVRTEGGFRLYTESDLQRLKFIRHARQLGFSLESI
Query Conservation    
 


   


  





  


 
  
    

 
    
  
  
  

  
  
  
Alig confidence 





















............












.....










Template Conservation 


  

   


 
 

  
 ............
    
   
  
.....
  
 
    
Template Sequence  MTQEDLAYKSNLDRTYISGIER. . . . . . . . . . . . NSRNLTIKSLELI. . . . . MKGLEVSDVVF
Template Known Secondary structure 

TTS
T............T




.....TT

Template Predicted Secondary structure 




............





.....


Template SS confidence 






























































   22.......30.........40... ......50...... ...60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions