Return to main results Retrieve Phyre Job Id

Job DescriptionP77561
Confidence41.06%DateThu Jan 5 12:30:35 GMT 2012
Rank139Aligned Residues39
% Identity18%Templatec3iwfA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcription regulator rpir family; PDBTitle: the crystal structure of the n-terminal domain of a rpir2 transcriptional regulator from staphylococcus epidermidis to 1.4a
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   290.........300.........310.........320.........330.........340.........350......
Predicted Secondary structure 























Query SS confidence 


































































Query Sequence  MMRLLIERDDAASAAGRPSLLDDEFIQTHTVGFDELRRDVLNSEWKDIERISGLSQTQIAELADAYA
Query Conservation 
   

             
 
  

   
 


     
   
 
  
 



  
 
  

   
Alig confidence 







............................






























Template Conservation 

 


  ............................       

 


    

 


 

 



Template Sequence  IAQFILNY. . . . . . . . . . . . . . . . . . . . . . . . . . . . PHKVVNXTSQEIANQLETSSTSIIRLSKKVT
Template Known Secondary structure 
............................TT

TS
S
Template Predicted Secondary structure 
............................





Template SS confidence 


































































   22....... 30.........40.........50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions