Return to main results Retrieve Phyre Job Id

Job DescriptionP46133
Confidence4.46%DateThu Jan 5 12:04:06 GMT 2012
Rank43Aligned Residues31
% Identity13%Templatec2voyB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:sarcoplasmic/endoplasmic reticulum calcium PDBTitle: cryoem model of copa, the copper transporting atpase from2 archaeoglobus fulgidus
Resolution17.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.......
Predicted Secondary structure 








Query SS confidence 








































Query Sequence  PSSSQSGKLYGWVERIGNKVPHPFLLFIYLIIVLMVTTAIL
Query Conservation               
  




    
   
     


 
 
Alig confidence 














..........















Template Conservation     
     
 

 
..........  
 

  

 

  
Template Sequence  EGKSLWELVIEQFED. . . . . . . . . . LLVRILLLAACISFVL
Template Known Secondary structure 


SSTTS..........
Template Predicted Secondary structure 



..........
Template SS confidence 








































   45....50......... 60.........70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions