Return to main results Retrieve Phyre Job Id

Job DescriptionP0A887
Confidence22.54%DateThu Jan 5 11:07:11 GMT 2012
Rank396Aligned Residues49
% Identity22%Templatec2c1iA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:peptidoglycan glcnac deacetylase; PDBTitle: structure of streptococcus pnemoniae peptidoglycan2 deacetylase (sppgda) d 275 n mutant.
Resolution1.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   147..150.........160.........170.........180.........190.........200.........210.........220......
Predicted Secondary structure 


























Query SS confidence 















































































Query Sequence  TDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAYSFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQ
Query Conservation        
    
 




   
                                                   

   
 
Alig confidence 































.......................................








Template Conservation       
   
      
 





    

 
.......................................
  

  

Template Sequence  KNEASILTEIQHQVANGSIVLMHDIHSPTVNA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LPRVIEYLK
Template Known Secondary structure 



TTTTS.......................................
Template Predicted Secondary structure 









.......................................
Template SS confidence 















































































   395....400.........410.........420...... ...430.....
 
   227..230....
Predicted Secondary structure 



Query SS confidence 







Query Sequence  DAGFESVD
Query Conservation   


  
 
Alig confidence 







Template Conservation    

 


Template Sequence  NQGYTFVT
Template Known Secondary structure  TT


Template Predicted Secondary structure 


Template SS confidence 







   436...440...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions