Return to main results Retrieve Phyre Job Id

Job DescriptionP0A940
Confidence4.53%DateThu Jan 5 11:09:19 GMT 2012
Rank45Aligned Residues30
% Identity17%Templatec3j00Z_
PDB info PDB header:ribosome/ribosomal proteinChain: Z: PDB Molecule:cell division protein ftsq; PDBTitle: structure of the ribosome-secye complex in the membrane environment
Resolution7.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20 .........30......
Predicted Secondary structure 
..........





Query SS confidence 













. . . . . . . . . .















Query Sequence  LIASLLFSSATVYG. . . . . . . . . . AEGFVVKDIHFEGLQR
Query Conservation      

        ..........     
  
 
 
   
Alig confidence 













..........















Template Conservation 
 
 
 

  
   
  
  

      

  
 
 
   
Template Sequence  ILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERH
Template Known Secondary structure  S









SSS





Template Predicted Secondary structure 









Template SS confidence 







































   28.30.........40.........50.........60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions