Return to main results Retrieve Phyre Job Id

Job DescriptionP69902
Confidence37.61%DateThu Jan 5 12:12:16 GMT 2012
Rank211Aligned Residues45
% Identity20%Templatec3rfqC_
PDB info PDB header:biosynthetic proteinChain: C: PDB Molecule:pterin-4-alpha-carbinolamine dehydratase moab2; PDBTitle: crystal structure of pterin-4-alpha-carbinolamine dehydratase moab22 from mycobacterium marinum
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60.........70.........80......... 90......
Predicted Secondary structure 


























.


Query SS confidence 






































































.






Query Sequence  GPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPDIDALYFTMLNSNKRSIELNTKTAEGKEVMEKLIRE. ADILVEN
Query Conservation 

 
   











 
  

  
          
      






 


    
   
  

  .




 
Alig confidence 





















.................................















.






Template Conservation     
   
   
  
     
 .................................

   
   
        





Template Sequence  GPLVTELLTEAGFVVDGVVAVE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ADEVDIRNALNTAVIGGVDLVVSV
Template Known Secondary structure  TT
.................................S
TT
S
Template Predicted Secondary structure 




.................................





Template SS confidence 














































































   46...50.........60....... ..70.........80.........90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions