Return to main results Retrieve Phyre Job Id

Job DescriptionP69902
Confidence52.76%DateThu Jan 5 12:12:16 GMT 2012
Rank132Aligned Residues45
% Identity22%Templatec2is8A_
PDB info PDB header:structural proteinChain: A: PDB Molecule:molybdopterin biosynthesis enzyme, moab; PDBTitle: crystal structure of the molybdopterin biosynthesis enzyme moab2 (ttha0341) from thermus theromophilus hb8
Resolution1.64 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60.........70.........80......... 90......
Predicted Secondary structure 


























..


Query SS confidence 






































































. .






Query Sequence  GPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPDIDALYFTMLNSNKRSIELNTKTAEGKEVMEKLIRE. . ADILVEN
Query Conservation 

 
   











 
  

  
          
      






 


    
   
  

  ..




 
Alig confidence 





















.................................















..






Template Conservation     
   
   
  
     
 .................................

   
   
         





Template Sequence  HLAIREVLAGGPFEVAAYELVP. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DEPPMIKKVLRLWADREGLDLILTN
Template Known Secondary structure  TTSS
.................................S
TS

S
Template Predicted Secondary structure 



.................................






Template SS confidence 















































































   23......30.........40.... .....50.........60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions