Return to main results Retrieve Phyre Job Id

Job DescriptionP69902
Confidence44.00%DateThu Jan 5 12:12:16 GMT 2012
Rank170Aligned Residues55
% Identity24%Templatec1uz5A_
PDB info PDB header:molybdopterin biosynthesisChain: A: PDB Molecule:402aa long hypothetical molybdopterin PDBTitle: the crystal structure of molybdopterin biosynthesis moea2 protein from pyrococcus horikosii
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60.........70.........80.........90......
Predicted Secondary structure 





























..
Query SS confidence 













































































. .
Query Sequence  GPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPDIDALYFTMLNSNKRSIELNTKTAEGKEVMEKLIREADILVEN. .
Query Conservation 

 
   











 
  

  
          
      






 


    
   
  

  




 
..
Alig confidence 





















.................................






















..
Template Conservation     
 
 
   
  
     
 .................................

   
  

  
    







Template Sequence  GRALCDAINELGGEGIFMGVAR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DDKESLKALIEKAVNVGDVVVISGG
Template Known Secondary structure  TS
.................................SS
S

Template Predicted Secondary structure 




.................................





Template SS confidence 















































































   209210.........220.........230 .........240.........250.....
 
   97..100......
Predicted Secondary structure  ..



Query SS confidence  . .









Query Sequence  . . FHPGAIDHMG
Query Conservation  ..  

 
 


Alig confidence  ..









Template Conservation   
     
   
Template Sequence  ADLTASVIEELG
Template Known Secondary structure 

S
Template Predicted Secondary structure 

Template SS confidence 











   256...260.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions