Return to main results Retrieve Phyre Job Id

Job DescriptionP14175
Confidence100.00%DateThu Jan 5 11:33:55 GMT 2012
Rank12Aligned Residues240
% Identity38%Templatec2olkD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:amino acid abc transporter; PDBTitle: abc protein artp in complex with adp-beta-s
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70.........80
Predicted Secondary structure 



























Query SS confidence 















































































Query Sequence  MAIKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP
Query Conservation           
 
                       
  
   

  

  
  


  
 
 

 





  
 
    
Alig confidence 

.















........................




































Template Conservation 
 . 
 
 


  
     ........................
  

  
  


  
 
 









 
 
    
Template Sequence  LQ. MIDVHQLKKSFGSLEV. . . . . . . . . . . . . . . . . . . . . . . . LKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDF
Template Known Secondary structure 

.SSSS
........................
TT

STTSSTTSS

Template Predicted Secondary structure 

.

........................
















Template SS confidence 















































































  
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions