Return to main results Retrieve Phyre Job Id

Job DescriptionP24169
Confidence62.46%DateThu Jan 5 11:40:44 GMT 2012
Rank336Aligned Residues24
% Identity13%Templatec2e8yA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:amyx protein; PDBTitle: crystal structure of pullulanase type i from bacillus subtilis str.2 168
Resolution2.11 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   294.. ...300.........310.......
Predicted Secondary structure  ........


Query SS confidence 


. . . . . . . .




















Query Sequence  DGT. . . . . . . . IYNARQVVDKIGHLCDYILFD
Query Conservation   

........  

  

   
     



Alig confidence 


........




















Template Conservation 


 
        


 

  

  

 



Template Sequence  YASNPHDPQTRKTELKQMINTLHQHGLRVILD
Template Known Secondary structure  TSS
SSSTT
Template Predicted Secondary structure 













Template SS confidence 































   304.....310.........320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions