Return to main results Retrieve Phyre Job Id

Job DescriptionP03023
Confidence90.74%DateThu Jan 5 10:57:56 GMT 2012
Rank341Aligned Residues33
% Identity18%Templatec3s2wB_
PDB info PDB header:transcription regulatorChain: B: PDB Molecule:transcriptional regulator, marr family; PDBTitle: the crystal structure of a marr transcriptional regulator from2 methanosarcina mazei go1
Resolution2.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40........
Predicted Secondary structure 

















Query SS confidence 















































Query Sequence  MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYI
Query Conservation 

 


 


  



  






    

  

 

   
 



 
Alig confidence 

























...............






Template Conservation      
  


  
 
   


  
  ...............

  
 
Template Sequence  EDGINQESLSDYLKIDKGTTARAIQK. . . . . . . . . . . . . . . LVDEGYV
Template Known Secondary structure  SSST

...............TTS
Template Predicted Secondary structure 







...............


Template SS confidence 















































   5960.........70.........80.... .....90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions