Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACS7
Confidence94.47%DateThu Jan 5 11:18:55 GMT 2012
Rank131Aligned Residues25
% Identity16%Templatec3h5tA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, laci family; PDBTitle: crystal structure of a transcriptional regulator, lacl2 family protein from corynebacterium glutamicum
Resolution2.53 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60...... ...70...
Predicted Secondary structure 



..................

Query SS confidence 

















. . . . . . . . . . . . . . . . . .






Query Sequence  AIKDVAEALAVSEAMIVK. . . . . . . . . . . . . . . . . . VSKLLGF
Query Conservation 

  

    

 


 
..................
 




Alig confidence 

















..................






Template Conservation 

 


   


  






    

  

 

   
  


Template Sequence  TLASIAAKLGISRTTVSNAYNRPEQLSAELRQRILDTAEDMGY
Template Known Secondary structure  TS

GGGS
TT
Template Predicted Secondary structure 












Template SS confidence 










































   11........20.........30.........40.........50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions