Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACS7
Confidence69.81%DateThu Jan 5 11:18:55 GMT 2012
Rank422Aligned Residues38
% Identity5%Templatec2xcjB_
PDB info PDB header:viral proteinChain: B: PDB Molecule:c protein; PDBTitle: crystal structure of p2 c, the immunity repressor of2 temperate e. coli phage p2
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........
Predicted Secondary structure 











Query SS confidence 
























































Query Sequence  GIGLAPYLRMKQEGMTENESRIVEWLLKPGNLSCAPAIKDVAEALAVSEAMIVKVSK
Query Conservation     
   
      

  
  

 


 
   
   

  

    

 


 

 
Alig confidence 















...................





















Template Conservation 
 


 


  
   
...................


 


   


   

  
 
Template Sequence  SNTISEKIVLMRKSEY. . . . . . . . . . . . . . . . . . . LSRQQLADLTGVPYGTLSYYES
Template Known Secondary structure 


TT...................




Template Predicted Secondary structure 



...................





Template SS confidence 
























































   2.......10....... ..20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions