Return to main results Retrieve Phyre Job Id

Job DescriptionP28903
Confidence72.80%DateThu Jan 5 11:45:16 GMT 2012
Rank53Aligned Residues30
% Identity23%Templatec2qkdA_
PDB info PDB header:signaling protein, cell cycleChain: A: PDB Molecule:zinc finger protein zpr1; PDBTitle: crystal structure of tandem zpr1 domains
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   642.......650....... ..660.........670.
Predicted Secondary structure 













...........













Query SS confidence 















. . . . . . . . . . .













Query Sequence  DECYECGFTGEFECTS. . . . . . . . . . . KGFTCPKCGNHDAS
Query Conservation 
 
  

  
     
...........    

 

     
Alig confidence 















...........













Template Conservation 


  

  
 

 
   



 



 

 
  




 
Template Sequence  SLCMNCYRNGTTRLLLTKIPFFREIIVSSFSCEHCGWNNTE
Template Known Secondary structure 
TTTSSTTT
TTT

Template Predicted Secondary structure 

























Template SS confidence 








































   4950.........60.........70.........80.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions