Return to main results Retrieve Phyre Job Id

Job DescriptionP28903
Confidence22.80%DateThu Jan 5 11:45:16 GMT 2012
Rank193Aligned Residues25
% Identity20%Templatec2e2zA_
PDB info PDB header:protein transport, chaperone regulatorChain: A: PDB Molecule:tim15; PDBTitle: solution nmr structure of yeast tim15, co-chaperone of2 mitochondrial hsp70
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   643......650.........660 .......
Predicted Secondary structure 















.......






Query SS confidence 

















. . . . . . .






Query Sequence  ECYECGFTGEFECTSKGF. . . . . . . TCPKCGN
Query Conservation   
  

  
     
   ....... 

 

 
Alig confidence 

















.......






Template Conservation 

  
  

 
 


 

  




 
 

 
Template Sequence  TCKKCNTRSSHTMSKQAYEKGTVLISCPHCKV
Template Known Secondary structure  TTTTTS
TTT

Template Predicted Secondary structure 



















Template SS confidence 































   15....20.........30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions