Return to main results Retrieve Phyre Job Id

Job DescriptionP63264
Confidence82.71%DateThu Jan 5 12:08:02 GMT 2012
Rank36Aligned Residues47
% Identity17%Templatec3b7hA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:prophage lp1 protein 11; PDBTitle: crystal structure of the prophage lp1 protein 11
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.........70
Predicted Secondary structure 





















Query SS confidence 






























































Query Sequence  FTITEFCLHTGISEEELNEIVGLGVVEPREIQETTWVFDDHAAIVVQRAVRLRHELALDWPGI
Query Conservation   

 
 
   


   

 
   


 
         
      

  
 

 



  
  
Alig confidence 




























................

















Template Conservation   
   

   


  

     
      ................   
  

  
 
    
Template Sequence  LTINRVATLAGLNQSTVNAMFEGRSKRPT. . . . . . . . . . . . . . . . ITTIRKVCGTLGISVHDF
Template Known Secondary structure 

T


TT




................T

Template Predicted Secondary structure 









................


Template SS confidence 






























































   21........30.........40......... 50.........60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions