Return to main results Retrieve Phyre Job Id

Job DescriptionP00561
Confidence79.78%DateThu Jan 5 10:56:43 GMT 2012
Rank348Aligned Residues29
% Identity14%Templatec3l4bG_
PDB info PDB header:transport proteinChain: G: PDB Molecule:trka k+ channel protien tm1088b; PDBTitle: crystal structure of an octomeric two-subunit trka k+ channel ring2 gating assembly, tm1088a:tm1088b, from thermotoga maritima
Resolution3.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   466...470.........480.........490.........500.
Predicted Secondary structure 








Query SS confidence 



































Query Sequence  IEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVC
Query Conservation 
 
 
 
 
 

  
   
      
        
 
Alig confidence 





















.......






Template Conservation 
 




 
  
  

  
   .......
  



Template Sequence  MKVIIIGGETTAYYLARSMLSR. . . . . . . KYGVVII
Template Known Secondary structure 



T.......T

Template Predicted Secondary structure 




.......


Template SS confidence 



































   1........10.........20.. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions