Return to main results Retrieve Phyre Job Id

Job DescriptionP00561
Confidence92.08%DateThu Jan 5 10:56:43 GMT 2012
Rank248Aligned Residues32
% Identity9%Templatec3hjaB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:glyceraldehyde-3-phosphate dehydrogenase; PDBTitle: crystal structure of glyceraldehyde-3-phosphate2 dehydrogenase from borrelia burgdorferi
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   466...470.........480.........490.........500......
Predicted Secondary structure 









Query SS confidence 








































Query Sequence  IEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVCGVANS
Query Conservation 
 
 
 
 
 

  
   
      
        
  
  
Alig confidence 





















.........









Template Conservation 












  

 
   .........  






 
Template Sequence  MKLAINGFGRIGRNVFKIAFER. . . . . . . . . GIDIVAINDL
Template Known Secondary structure 


ST.........T

S
Template Predicted Secondary structure 





.........




Template SS confidence 








































   1........10.........20.. .......30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions