Return to main results Retrieve Phyre Job Id

Job DescriptionP21866
Confidence20.31%DateThu Jan 5 11:38:36 GMT 2012
Rank379Aligned Residues48
% Identity15%Templatec3ketA_
PDB info PDB header:transcription/dnaChain: A: PDB Molecule:redox-sensing transcriptional repressor rex; PDBTitle: crystal structure of a rex-family transcriptional regulatory protein2 from streptococcus agalactiae bound to a palindromic operator
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   157..160.........170.........180.........190.........200.........210.........220.
Predicted Secondary structure 






























Query SS confidence 
































































Query Sequence  FRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGY
Query Conservation    

  
      



  
   

         

   
 


 

         
 

 
 

Alig confidence 























.....



.......













.....





Template Conservation     
  
   
   


  

   .....

  .......  





  
  
.....  
 

Template Sequence  YRIFKRFNTDGIEKASSKQIADAL. . . . . GIDS. . . . . . . ATVRRDFSYFGELG. . . . . RRGFGY
Template Known Secondary structure  TT


.....TS
.......TT


S.....BTTTB
Template Predicted Secondary structure 



.....


.......

.....





Template SS confidence 
































































   1920.........30.........40.. .... ...50.........60 ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions