Return to main results Retrieve Phyre Job Id

Job DescriptionP36680
Confidence5.70%DateThu Jan 5 11:53:46 GMT 2012
Rank50Aligned Residues23
% Identity30%Templatec1p65A_
PDB info PDB header:viral proteinChain: A: PDB Molecule:nucleocapsid protein; PDBTitle: crystal structure of the nucleocapsid protein of porcine reproductive2 and respiratory syndrome virus (prrsv)
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118.120.........130.. .......140
Predicted Secondary structure 







............



Query SS confidence 














. . . . . . . . . . . .







Query Sequence  IALVRQRLSIPGGCC. . . . . . . . . . . . SFDLPTLH
Query Conservation 
  



  



 
............ 



 

Alig confidence 














............







Template Conservation   


 
 



 

 

 


 




 




  
Template Sequence  LSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHH
Template Known Secondary structure  T
S
TTS






Template Predicted Secondary structure 









Template SS confidence 


































   25....30.........40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions