Return to main results Retrieve Phyre Job Id

Job DescriptionP04995
Confidence3.41%DateThu Jan 5 10:58:34 GMT 2012
Rank87Aligned Residues39
% Identity10%Templatec2w48D_
PDB info PDB header:transcriptionChain: D: PDB Molecule:sorbitol operon regulator; PDBTitle: crystal structure of the full-length sorbitol operon2 regulator sorc from klebsiella pneumoniae
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   140.........150.........160.........170.........180.........190
Predicted Secondary structure 


























Query SS confidence 


















































Query Sequence  VMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNAHDAMADVYAT
Query Conservation    
    
 
    
     
  
 

  
    

    




 

 

Alig confidence 











............


























Template Conservation     

 


  
............ 

 


  




  




  

  
Template Sequence  IVKIAQLYYEQD. . . . . . . . . . . . MTQAQIARELGIYRTTISRLLKRGREQ
Template Known Secondary structure  S
............

T

ST
Template Predicted Secondary structure 

............





Template SS confidence 


















































   10.........20. ........30.........40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions