Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7J7
Confidence4.74%DateThu Jan 5 11:05:47 GMT 2012
Rank64Aligned Residues22
% Identity36%Templatec2kqzA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:proteasomal ubiquitin receptor adrm1; PDBTitle: fragment of proteasome protein
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30... ......40.....
Predicted Secondary structure 





...........
Query SS confidence 









. . . . . . . . . . .











Query Sequence  VGPALGQQGV. . . . . . . . . . . NIMEFCKAFNAK
Query Conservation 


 

  

...........

  
 
 

  
Alig confidence 









...........











Template Conservation 
  

  


   
  

  
 

 

 

   
Template Sequence  LGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNN
Template Known Secondary structure  STT

T
Template Predicted Secondary structure 







Template SS confidence 
































   352.......360.........370.........380....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions