Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7J7
Confidence13.07%DateThu Jan 5 11:05:47 GMT 2012
Rank27Aligned Residues42
% Identity14%Templatec2asbA_
PDB info PDB header:transcription/rnaChain: A: PDB Molecule:transcription elongation protein nusa; PDBTitle: structure of a mycobacterium tuberculosis nusa-rna complex
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60.........70.........80....
Predicted Secondary structure 


















Query SS confidence 





























































Query Sequence  PVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAA
Query Conservation 



 

  



  
 
 

  
     
  


 
 
  


    
  

 
 

 


Alig confidence 




















....................




















Template Conservation 






  
 

  
  

 ....................






  
 
   

 


Template Sequence  AKGACIGPMGQRVRNVMSELS. . . . . . . . . . . . . . . . . . . . GEKIDIIDYDDDPARFVANAL
Template Known Secondary structure 
GGGTT....................T


SST
Template Predicted Secondary structure 




....................







Template SS confidence 





























































   231........240.........250. ........260.........270..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions