Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7J7
Confidence7.42%DateThu Jan 5 11:05:47 GMT 2012
Rank43Aligned Residues42
% Identity24%Templatec1hh2P_
PDB info PDB header:transcription regulationChain: P: PDB Molecule:n utilization substance protein a; PDBTitle: crystal structure of nusa from thermotoga maritima
Resolution2.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60.........70.........80....
Predicted Secondary structure 


















Query SS confidence 





























































Query Sequence  PVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAA
Query Conservation 



 

  



  
 
 

  
     
  


 
 
  


    
  

 
 

 


Alig confidence 




















....................




















Template Conservation 


  

  
 

  
   
 .................... 
 



    
    
 
 
Template Sequence  PIGACIGEGGSRIAAILKELK. . . . . . . . . . . . . . . . . . . . GEKLDVLKWSDDPKQLIANAL
Template Known Secondary structure 
TTSTTTT....................T


SST
Template Predicted Secondary structure 




....................







Template SS confidence 





























































   246...250.........260...... ...270.........280.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions