Return to main results Retrieve Phyre Job Id

Job DescriptionP26365
Confidence16.03%DateThu Jan 5 11:42:53 GMT 2012
Rank66Aligned Residues35
% Identity43%Templatec2vefB_
PDB info PDB header:transferaseChain: B: PDB Molecule:dihydropteroate synthase; PDBTitle: dihydropteroate synthase from streptococcus pneumoniae
Resolution1.8 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   194.....200.........210.........220.........230.........240
Predicted Secondary structure 

















Query SS confidence 














































Query Sequence  IAIDAGHGGQDPGAIGPGGTREKNVTIAIARKLRTLLNDDPMFKGVL
Query Conservation 



 



 



 
  
  

 
 
 

  
   
    
  
 
Alig confidence 





........








..










..








Template Conservation 





........


 
    ..

 

      ..  

 


 
Template Sequence  ILLDPG. . . . . . . . IGFGLTKKE. . NLLLLRDLDKL. . HQKGYPIFL
Template Known Secondary structure 

........TTSS

..T..TTSS
B
Template Predicted Secondary structure 

........





....



Template SS confidence 














































   198.200... ......210.. .......220... ......230..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions