Return to main results Retrieve Phyre Job Id

Job DescriptionP76056
Confidence6.79%DateWed Jan 25 15:21:05 GMT 2012
Rank87Aligned Residues30
% Identity27%Templatec1f8aB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:peptidyl-prolyl cis-trans isomerase nima- PDBTitle: structural basis for the phosphoserine-proline recognition2 by group iv ww domains
Resolution1.84 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.........90
Predicted Secondary structure 












Query SS confidence 



















































Query Sequence  NIKKAGNLRALIVHEINSGEFEYLRRFPQSSTGAKMVTTRVIKTFGELCDIW
Query Conservation      
          
  
                        
  
     
Alig confidence 





















......................







Template Conservation   
 

   
  
   
  
   ......................
  

   
Template Sequence  TKEEALELINGYIQKIKSGEED. . . . . . . . . . . . . . . . . . . . . . FESLASQF
Template Known Secondary structure 
TTSS
......................
Template Predicted Secondary structure 



......................
Template SS confidence 



















































   85....90.........100...... ...110....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions