Return to main results Retrieve Phyre Job Id

Job DescriptionP76044
Confidence55.85%DateThu Jan 5 12:17:47 GMT 2012
Rank253Aligned Residues30
% Identity17%Templatec2wgkA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:3,6-diketocamphane 1,6 monooxygenase; PDBTitle: type ii baeyer-villiger monooxygenase oxygenating2 constituent of 3,6-diketocamphane 1,6 monooxygenase from3 pseudomonas putida
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.. .......20.........30
Predicted Secondary structure 






.........




Query SS confidence 











. . . . . . . . .

















Query Sequence  MKIGTQNQAFFP. . . . . . . . . ENILEKFRYIKEMGFDGF
Query Conservation 



        .........  
   
      
   
Alig confidence 











.........

















Template Conservation 
  
 
                   
 
  

 



  
Template Sequence  METGLIFHPYMRPGRSARQTFDWGIKSAVQADSVGIDSM
Template Known Secondary structure 





TT

TT

Template Predicted Secondary structure 













Template SS confidence 






































   3......10.........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions