Return to main results Retrieve Phyre Job Id

Job DescriptionP76044
Confidence23.87%DateThu Jan 5 12:17:47 GMT 2012
Rank489Aligned Residues47
% Identity32%Templatec1zczA_
PDB info PDB header:transferase/hydrolaseChain: A: PDB Molecule:bifunctional purine biosynthesis protein purh; PDBTitle: crystal structure of phosphoribosylaminoimidazolecarboxamide2 formyltransferase / imp cyclohydrolase (tm1249) from thermotoga3 maritima at 1.88 a resolution
Resolution1.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   81........90.........100.........110.........120.........130.........140.........150.
Predicted Secondary structure 





























Query SS confidence 






































































Query Sequence  IERILEALAEVGGKGIVVPAAWGMFTFRLPPMTSPRSLDGDRKMVSDSLRVLEQVAARTGTVVYLEPLNRY
Query Conservation      
  
  

   
                                
      
   

    
     
Alig confidence 
























........................





















Template Conservation 
 
 
  

  

 










........................ 


 



 







 


Template Sequence  FPDSLEILAQAGVKAVVAPLGSIRD. . . . . . . . . . . . . . . . . . . . . . . . EEVIEKARELGITFYKAPSRVF
Template Known Secondary structure  STT





TT........................T

SS


Template Predicted Secondary structure 












........................








Template SS confidence 






































































   404.....410.........420........ .430.........440.........450
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions