Return to main results Retrieve Phyre Job Id

Job DescriptionP75685
Confidence10.94%DateThu Jan 5 12:13:07 GMT 2012
Rank1Aligned Residues15
% Identity40%Templated3deoa1
SCOP infoSH3-like barrel Chromo domain-like Chromo domain
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   135....140.........150.........160.....
Predicted Secondary structure 






















Query SS confidence 






























Query Sequence  TPEAWVPALGDAHHGFPYLSGAGRLVLKDTL
Query Conservation 

 

   

    


 


 







 
Alig confidence 

.





...............






Template Conservation 

.




 ............... 

 


Template Sequence  SP. SWVPSS. . . . . . . . . . . . . . . YIAADVV
Template Known Secondary structure 

.GG...............GS
Template Predicted Secondary structure 

.



...............
Template SS confidence 






























   111. ...... .120.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions