Return to main results Retrieve Phyre Job Id

Job DescriptionP75685
Confidence1.52%DateThu Jan 5 12:13:07 GMT 2012
Rank79Aligned Residues22
% Identity41%Templatec3faoA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:non-structural protein; PDBTitle: crystal structure of s118a mutant 3clsp of prrsv
Resolution2.01 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   130.........140.........150.........160
Predicted Secondary structure 






















Query SS confidence 






























Query Sequence  SFLITTPEAWVPALGDAHHGFPYLSGAGRLV
Query Conservation 


 


 

   

    


 


 



Alig confidence 







.........













Template Conservation      
  
.........






   
  
Template Sequence  AFCFTACG. . . . . . . . . DAGSPVITEAGELV
Template Known Secondary structure  SS


.........STT
TTS
Template Predicted Secondary structure 


.........









Template SS confidence 






























   109110...... ...120.........130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions