Return to main results Retrieve Phyre Job Id

Job DescriptionP45564
Confidence2.79%DateThu Jan 5 12:03:17 GMT 2012
Rank42Aligned Residues32
% Identity25%Templatec3ggqA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:capsid protein; PDBTitle: dimerization of hepatitis e virus capsid protein e2s domain is2 essential for virus-host interaction
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60.......
Predicted Secondary structure 
























Query SS confidence 










































Query Sequence  KGGFADIGVHYLDWTSRTTEKSSTKSHKDDFGYLEFEGGANFS
Query Conservation       


  
 
      
         
   

 
 


  
Alig confidence 

















.........



..









Template Conservation   



   


 





......... 

 ..
  




  
Template Sequence  FWEAGTTKAGYPYNYNTT. . . . . . . . . ASDQ. . LLVENAAGHR
Template Known Secondary structure  TTS

B


TTTTSS.........


..SSTT

Template Predicted Secondary structure 











.........
..




Template SS confidence 










































   547..550.........560.... .... .570........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions