Return to main results Retrieve Phyre Job Id

Job DescriptionP71296
Confidence47.97%DateThu Jan 5 12:12:41 GMT 2012
Rank1Aligned Residues27
% Identity33%Templatec3ebkA_
PDB info PDB header:allergenChain: A: PDB Molecule:allergen bla g 4; PDBTitle: crystal structure of major allergens, bla g 4 from2 cockroaches
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   219220.........230.........240.........250...
Predicted Secondary structure 










Query SS confidence 


































Query Sequence  LIIFGINEVLRRKGIVMPYPVVCWIDIYHVNEMVV
Query Conservation 

  



   
  
  
    





 


  
Alig confidence 













........












Template Conservation 













........

 
 
    


Template Sequence  IIAAGTSEALTQYK. . . . . . . . CWIDRFSYDDALV
Template Known Secondary structure  S
SGGGGS........TTT
Template Predicted Secondary structure 


........

Template SS confidence 


































   30.........40... ......50......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions