Return to main results Retrieve Phyre Job Id

Job DescriptionP31135
Confidence1.57%DateThu Jan 5 11:47:19 GMT 2012
Rank76Aligned Residues40
% Identity30%Templated1v54m_
SCOP infoSingle transmembrane helix Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.........60.........70.........80........
Predicted Secondary structure 




















Query SS confidence 



































































Query Sequence  SQLQMKHGRKLVIALPYIWLILLFLLPFLIVFKISLAEMARAIPPYTELMEWADGQLSITLNLGNFLQ
Query Conservation              
           
 
    
  

                            

  
Alig confidence 































............................







Template Conservation 



   
   
 




  
   
 





............................ 


 


Template Sequence  AKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVL. . . . . . . . . . . . . . . . . . . . . . . . . . . . YHLDNYKK
Template Known Secondary structure 



SS


............................TT
Template Predicted Secondary structure 








............................
Template SS confidence 



































































   3......10.........20.........30.... .....40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions