Return to main results Retrieve Phyre Job Id

Job DescriptionP42615
Confidence3.43%DateThu Jan 5 12:01:49 GMT 2012
Rank88Aligned Residues28
% Identity7%Templatec3qthA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of a hypothetical dinb-like protein (cps_3021) from2 colwellia psychrerythraea 34h at 2.20 a resolution
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60........
Predicted Secondary structure 




















Query SS confidence 












































Query Sequence  LLLAWSAVRQQESTLAIRAVHQGTTMPDGFSIWHHLDAHGIPFKS
Query Conservation   




 

  
 



 
   
  


   
 
 
   

  

Alig confidence 











.................















Template Conservation    
 






 .................







  

 


Template Sequence  SSFVLPNFFFHI. . . . . . . . . . . . . . . . . SXVYAIAKNNGVSVTK
Template Known Secondary structure  T.................TT



Template Predicted Secondary structure 




.................






Template SS confidence 












































   131........140.. .......150........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions