Return to main results Retrieve Phyre Job Id

Job DescriptionO52982
Confidence2.37%DateThu Jan 5 10:56:32 GMT 2012
Rank97Aligned Residues40
% Identity18%Templatec2r5kE_
PDB info PDB header:viral proteinChain: E: PDB Molecule:major capsid protein l1; PDBTitle: pentamer structure of major capsid protein l1 of human2 papilloma virus type 11
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.........70.........80.........90...
Predicted Secondary structure 



























Query SS confidence 

























































Query Sequence  DLTPPRFSDVVSRQDDVSEEWSQVGFSSGLTLQVLRTRESPDGCEGGSYYYLVDMEEK
Query Conservation 




 







 

 


 
 
    
   











 





 




Alig confidence 





























..................









Template Conservation   
  



 
  


 


 
   



  .................. 

 

  

Template Sequence  TLSAEVMAYIHTMNPSVLEDWNKQDPYKDM. . . . . . . . . . . . . . . . . . SFWEVNLKEK
Template Known Secondary structure 







TTSSS..................


GGG
Template Predicted Secondary structure 













..................



Template SS confidence 

























































   378.380.........390.........400....... ..410.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions