Return to main results Retrieve Phyre Job Id

Job DescriptionP76334
Confidence3.61%DateThu Jan 5 12:21:54 GMT 2012
Rank61Aligned Residues31
% Identity39%Templatec2b9sA_
PDB info PDB header:isomerase/dnaChain: A: PDB Molecule:topoisomerase i-like protein; PDBTitle: crystal structure of heterodimeric l. donovani2 topoisomerase i-vanadate-dna complex
Resolution2.27 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40...
Predicted Secondary structure 

















Query SS confidence 










































Query Sequence  MEKCDFYHIIVLSLNFPGYLKMEYGSTKMEERLSRSPGGKLAL
Query Conservation 






























   

 





Alig confidence 








............





















Template Conservation     


  
............       

 

  




   
Template Sequence  LELCDFEPI. . . . . . . . . . . . YQWHLVQREKKLSRTKEEKKAI
Template Known Secondary structure  GGG
............TS
TT
Template Predicted Secondary structure 

............

Template SS confidence 










































   123......130. ........140.........150...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions