Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6J8
Confidence82.54%DateThu Jan 5 11:03:18 GMT 2012
Rank490Aligned Residues32
% Identity31%Templatec2weuD_
PDB info PDB header:antifungal proteinChain: D: PDB Molecule:tryptophan 5-halogenase; PDBTitle: crystal structure of tryptophan 5-halogenase (pyrh) complex2 with substrate tryptophan
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.... .....40..
Predicted Secondary structure 








...

Query SS confidence 

































. . .







Query Sequence  MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKS. . . RFDVVLLG
Query Conservation 
 
  
 

 

   
   
  
   
  

   ...
  
  
 
Alig confidence 



.






.........












...







Template Conservation   

 .






......... 

  

  


    
  




Template Sequence  MIRS. VVIVGGG. . . . . . . . . TAGWMTASYLKAAFDDRIDVTLVE
Template Known Secondary structure 


.

.........GGGS
Template Predicted Secondary structure 


.

.........



Template SS confidence 












































   1... .....10. ........20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions