Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6J8
Confidence87.94%DateThu Jan 5 11:03:18 GMT 2012
Rank315Aligned Residues34
% Identity21%Templatec1xdiA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:rv3303c-lpda; PDBTitle: crystal structure of lpda (rv3303c) from mycobacterium tuberculosis
Resolution2.81 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.... .....40.....
Predicted Secondary structure 








...




Query SS confidence 

































. . .










Query Sequence  MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKS. . . RFDVVLLGIDK
Query Conservation 
 
  
 

 

   
   
  
   
  

   ...
  
  
    
Alig confidence 


..






.........












...










Template Conservation 
 
..






......... 





  


    
  




   
Template Sequence  VTR. . IVILGGG. . . . . . . . . PAGYEAALVAATSHPETTQVTVIDCDG
Template Known Secondary structure 
..

S.........
TTTSS
Template Predicted Secondary structure 

..


.........








Template SS confidence 















































   2.. .....10. ........20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions