Return to main results Retrieve Phyre Job Id

Job DescriptionQ47688
Confidence35.31%DateThu Jan 5 12:37:02 GMT 2012
Rank28Aligned Residues52
% Identity23%Templatec1nh2D_
PDB info PDB header:transcription/dnaChain: D: PDB Molecule:transcription initiation factor iia small chain; PDBTitle: crystal structure of a yeast tfiia/tbp/dna complex
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   214.....220.........230.........240.........250.........260.........270.........280.....
Predicted Secondary structure 






































Query SS confidence 







































































Query Sequence  QGGVISPLLSNIMLNEFDQYLHERYLSGKARKDRWYWNNSIQRGRSTAVRENWQWKPAVAYCRYADDFVLIV
Query Conservation 

  




 

 
  

  
                                       






  
  
Alig confidence 


































....................
















Template Conservation      

  

 


  




   
   

 
   ....................

 
 


 






 
Template Sequence  SDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTV. . . . . . . . . . . . . . . . . . . . KGNLDTYGFCDDVWTFI
Template Known Secondary structure  TTSS
S


....................TT
Template Predicted Secondary structure 









....................

Template SS confidence 







































































   28.30.........40.........50.........60.. .......70.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions