Return to main results Retrieve Phyre Job Id

Job DescriptionP71243
Confidence43.40%DateThu Jan 5 12:12:38 GMT 2012
Rank237Aligned Residues28
% Identity21%Templatec3plnA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:udp-glucose 6-dehydrogenase; PDBTitle: crystal structure of klebsiella pneumoniae udp-glucose 6-dehydrogenase2 complexed with udp-glucose
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.....
Predicted Secondary structure 










Query SS confidence 


































Query Sequence  MKVGFFLLKFPLSSETFVLNQITAFIDMGFEVEIL
Query Conservation 


  
    
   
  
      
   
  
 
 
Alig confidence 











......








.






Template Conservation 


 




 

......   
  

 .
  
   
Template Sequence  MKITISGTGYVG. . . . . . LSNGVLIAQ. NHEVVAL
Template Known Secondary structure 


S......T.TS
Template Predicted Secondary structure 


......
.

Template SS confidence 


































   1........10.. .......20. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions