Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8P6
Confidence4.79%DateThu Jan 5 11:08:26 GMT 2012
Rank78Aligned Residues39
% Identity13%Templatec1umqA_
PDB info PDB header:dna-binding proteinChain: A: PDB Molecule:photosynthetic apparatus regulatory protein; PDBTitle: solution structure and dna binding of the effector domain2 from the global regulator prra(rega) from r. sphaeroides:3 insights into dna binding specificity
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   243......250.........260.........270.........280.........290...
Predicted Secondary structure 










Query SS confidence 


















































Query Sequence  RHSFATHMLESSGDLRGVQELLGHANLSTTQIYTHLDFQHLASVYDAAHPR
Query Conservation 


 

 
   
     
   


    

  
 
     
     
  

Alig confidence 






















............















Template Conservation 
  
  

    

   

  

............


 

 




   
Template Sequence  WEHIQRIYEMCDRNVSETARRLN. . . . . . . . . . . . MHRRTLQRILAKRSPR
Template Known Secondary structure  TTS
T............S
TSS

Template Predicted Secondary structure 



............




Template SS confidence 


















































   43......50.........60..... ....70.........80.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions