Return to main results Retrieve Phyre Job Id

Job DescriptionP23538
Confidence22.35%DateThu Jan 5 11:39:36 GMT 2012
Rank149Aligned Residues37
% Identity19%Templatec1s1iG_
PDB info PDB header:ribosomeChain: G: PDB Molecule:60s ribosomal protein l8-a; PDBTitle: structure of the ribosomal 80s-eef2-sordarin complex from2 yeast obtained by docking atomic models for rna and protein3 components into a 11.7 a cryo-em map. this file, 1s1i,4 contains 60s subunit. the 40s ribosomal subunit is in file5 1s1h.
Resolution11.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   383......390.........400.........410.........420.........430.....
Predicted Secondary structure 


















Query SS confidence 




















































Query Sequence  MNRIEPGDVLVTDMTDPDWEPIMKKASAIVTNRGGRTCHAAIIARELGIPAVV
Query Conservation          


     
          



  

 


 

 

  


 

Alig confidence 


















................

















Template Conservation 

  

 




 

 
 
................ 
 


 

    


  
Template Sequence  IENKKAKLVLIANDVDPIE. . . . . . . . . . . . . . . . LVVFLPALCKKMGVPYAI
Template Known Secondary structure  TT

S
SS

S

................STTSSSSSSTTTT

Template Predicted Secondary structure 







................




Template SS confidence 




















































   142.......150.........160 .........170........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions