Return to main results Retrieve Phyre Job Id

Job DescriptionP39297
Confidence5.23%DateThu Jan 5 11:59:03 GMT 2012
Rank59Aligned Residues27
% Identity19%Templatec3mi6A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:alpha-galactosidase; PDBTitle: crystal structure of the alpha-galactosidase from lactobacillus2 brevis, northeast structural genomics consortium target lbr11.
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100..
Predicted Secondary structure 









Query SS confidence 


































Query Sequence  DDALAEIKAKAVAAKADYYVVVMVDETIVTGQWYS
Query Conservation   
    

 


  

 

 


  
      
  
Alig confidence 




















........





Template Conservation     
  

  

 

 
 


........




 
Template Sequence  EAKLXTIVNQAKRLGIEXFVL. . . . . . . . DDGWFG
Template Known Secondary structure  T

........
TT
BT
Template Predicted Secondary structure 



........





Template SS confidence 


































   346...350.........360...... ...370..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions