Return to main results Retrieve Phyre Job Id

Job DescriptionP37647
Confidence30.98%DateThu Jan 5 11:56:19 GMT 2012
Rank78Aligned Residues31
% Identity29%Templatec3i3lA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:alkylhalidase cmls; PDBTitle: crystal structure of cmls, a flavin-dependent halogenase
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40.........50.
Predicted Secondary structure 


.











Query SS confidence 


.















































Query Sequence  MSK. KIAVIGECMIELSEKGADVKRGFGGDTLNTSVYIARQVDPAALTVHYV
Query Conservation 
  . 

 

   

            

   
 
  

 
    
      
Alig confidence 


.





................














....






Template Conservation 
   





................





 

  


 ....

 
 

Template Sequence  MTRSKVAIIG. . . . . . . . . . . . . . . . GGPAGSVAGLTLHKL. . . . GHDVTIY
Template Known Secondary structure 




................
ST....T
Template Predicted Secondary structure 




................


....

Template SS confidence 



















































   1........10 .........20..... ....30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions