Return to main results Retrieve Phyre Job Id

Job DescriptionP37647
Confidence21.53%DateThu Jan 5 11:56:19 GMT 2012
Rank91Aligned Residues40
% Identity23%Templatec3dfiA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:pseudoaglycone deacetylase dbv21; PDBTitle: the crystal structure of antimicrobial reagent a40926 pseudoaglycone2 deacetylase dbv21
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.......
Predicted Secondary structure 















Query SS confidence 






















































Query Sequence  KKIAVIGECMIELSEKGADVKRGFGGDTLNTSVYIARQVDPAALTVHYVTALGTD
Query Conservation    

 

   

            

   
 
  

 
    
        

 
Alig confidence 






.......












.......






.












Template Conservation   




 .......





 
  


.......

     .
  
 

 

 
 
Template Sequence  TRILAIS. . . . . . . PHLDDAVLSVGAS. . . . . . . LAQAEQD. GGKVTVFTVFAGS
Template Known Secondary structure  S.......SSTT.......T.T
SS


Template Predicted Secondary structure  .......



.......
.






Template SS confidence 






















































   8.10.... .....20....... ..30.... .....40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions