Return to main results Retrieve Phyre Job Id

Job DescriptionP37647
Confidence46.81%DateThu Jan 5 11:56:19 GMT 2012
Rank73Aligned Residues31
% Identity32%Templatec3d8xB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:thioredoxin reductase 1; PDBTitle: crystal structure of saccharomyces cerevisiae nadph dependent2 thioredoxin reductase 1
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.
Predicted Secondary structure 














Query SS confidence 


















































Query Sequence  MSKKIAVIGECMIELSEKGADVKRGFGGDTLNTSVYIARQVDPAALTVHYV
Query Conservation 
   

 

   

            

   
 
  

 
    
      
Alig confidence 








................














....






Template Conservation 
  





................

 


 

  
   ....
  
 

Template Sequence  VHNKVTIIG. . . . . . . . . . . . . . . . SGPAAHTAAIYLARA. . . . EIKPILY
Template Known Secondary structure 

................
ST....T


Template Predicted Secondary structure 




................


....


Template SS confidence 


















































   2.......10 .........20..... ....30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions